This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
BCR monoclonal antibody (M01), clone 2E5
catalog :
H00000613-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2E5
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
product information
catalog id :
H00000613-M01
product name :
BCR monoclonal antibody (M01), clone 2E5
product description :
Mouse monoclonal antibody raised against a partial recombinant BCR.
clone name :
2E5
isotype :
IgG2a Kappa
gene name :
BCR
gene alias :
ALL BCR-ABL1 BCR1 CML D22S11 D22S662 FLJ16453 PHL
gene description :
breakpoint cluster region
genbank accession :
NM_004327
immunogen :
BCR (NP_004318.3, 182 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
FHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAG
SSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDN
LIDANGGSRPPWPPLEYQPYQ
SSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDN
LIDANGGSRPPWPPLEYQPYQ
protein accession :
NP_004318.3
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce
size :
100 ug
autodate :
2008-07-31
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
