This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
BCAT1 monoclonal antibody (M02), clone 1F8
catalog :
H00000586-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00000586-M02
product name :
BCAT1 monoclonal antibody (M02), clone 1F8
product description :
Mouse monoclonal antibody raised against a full-length recombinant BCAT1.
clone name :
1F8
isotype :
IgG2a Kappa
gene name :
BCAT1
gene alias :
BCT1 DKFZp686E12175 ECA39 MECA39 PNAS-121 PP18
gene description :
branched chain aminotransferase 1, cytosolic
genbank accession :
BC033864
immunogen :
BCAT1 (AAH33864, 1 a.a. ~ 320 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKE
KPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNL
SLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMD
RMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTS
ASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSS
GTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQC
EAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEE
ELATPPLDGIILPGVTRRCILDLAHQWDTELSLFSINLP
DFLQFIYF
KPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNL
SLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMD
RMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTS
ASLYIRPTFIGTEPSLGVKKPTKALLFVLLSPVGPYFSS
GTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQC
EAVDNGCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEE
ELATPPLDGIILPGVTRRCILDLAHQWDTELSLFSINLP
DFLQFIYF
protein accession :
AAH33864
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,WB-Ti,S-ELISA,ELISA
size :
100 ug
autodate :
2008-06-23
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
