This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
BAD monoclonal antibody (M02), clone 3H8
catalog :
H00000572-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3H8
reactivity :
human
application :
western blot, ELISA
citations: 1
Reference
Gan L, Chen S, Zhong J, Wang X, Lam E, Liu X, et al. ZIC1 is downregulated through promoter hypermethylation, and functions as a tumor suppressor gene in colorectal cancer. PLoS ONE. 2011;6:e16916 pubmed publisher
product information
catalog id :
H00000572-M02
product name :
BAD monoclonal antibody (M02), clone 3H8
product description :
Mouse monoclonal antibody raised against a partial recombinant BAD.
clone name :
3H8
isotype :
IgG2a lambda
gene name :
BAD
gene alias :
BBC2 BCL2L8
gene description :
BCL2-associated agonist of cell death
genbank accession :
BC001901
immunogen :
BAD (AAH01901, 69 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
IRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAA
QRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSS
WTRVFQSWWDRNLGRGSSAPSQ
protein accession :
AAH01901
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,PLA-Ce
size :
100 ug
autodate :
2006-10-27
updatetime :
2013-11-15 18:37:01
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098