product summary
Loading...
company name :
Abnova
product type :
antibody
product name :
ASNA1 monoclonal antibody (M03), clone 2H3
catalog :
H00000439-M03
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2H3
reactivity :
human, rat
application :
western blot, ELISA, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 2
| Published Application/Species/Sample/Dilution | Reference |
|---|---|
| |
product information
catalog id :
H00000439-M03
product name :
ASNA1 monoclonal antibody (M03), clone 2H3
product description :
Mouse monoclonal antibody raised against a partial recombinant ASNA1.
clone name :
2H3
isotype :
IgG1 Kappa
gene name :
ASNA1
gene alias :
ARSA-I ARSA1 MGC3821
gene description :
arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)
genbank accession :
NM_004317
immunogen :
ASNA1 (NP_004308, 239 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
PEQTTFICVCIAEFLSLYETERLIQELAKCKIDTHNIIV
NQLVFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIV
KLPLLPHEVRGADKVNTFSALLLEPYKPPSAQ
NQLVFPDPEKPCKMCEARHKIQAKYLDQMEDLYEDFHIV
KLPLLPHEVRGADKVNTFSALLLEPYKPPSAQ
protein accession :
NP_004308
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Rat
application key :
WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
more info or order :
company information

Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
related products
browse more products
- ASNS purified MaxPab mouse polyclonal antibody (B01P) | H00000440-B01P
- ASNS MaxPab rabbit polyclonal antibody (D01) | H00000440-D01
- ASNS purified MaxPab rabbit polyclonal antibody (D01P) | H00000440-D01P
- ASNS monoclonal antibody (M01), clone 3B3 | H00000440-M01
- ASNS monoclonal antibody (M02), clone 2B3 | H00000440-M02
questions and comments
