ARF5 monoclonal antibody (M01), clone 1B4 | Abnova H00000381-M01 product information

product summary

company name :

Abnova

product type :

antibody

product name :

ARF5 monoclonal antibody (M01), clone 1B4

catalog :

H00000381-M01

quantity :

100 ug

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

1B4

reactivity :

human, mouse, rat

application :

western blot, ELISA, immunocytochemistry

more info or order :

Abnova product webpage

citations: 9

Published Application/Species/Sample/Dilution	Reference
western blot; human; 1:200; loading ...; fig 1a	Fayad R, Rojas M, Partisani M, Finetti P, Dib S, Abélanet S, et al. EFA6B regulates a stop signal for collective invasion in breast cancer. Nat Commun. 2021;12:2198 pubmed publisher
western blot; human; 1:500; loading ...; fig s3a	Ramírez Peinado S, Ignashkova T, van Raam B, Baumann J, Sennott E, Gendarme M, et al. TRAPPC13 modulates autophagy and the response to Golgi stress. J Cell Sci. 2017;130:2251-2265 pubmed publisher
western blot; human	MÃ¼nzberg C, HÃ¶hn K, Krndija D, MaaÃŸ U, Bartsch D, Slater E, et al. IGF-1 drives chromogranin A secretion via activation of Arf1 in human neuroendocrine tumour cells. J Cell Mol Med. 2015;19:948-59 pubmed publisher
	Takashima K, Saitoh A, Hirose S, Nakai W, Kondo Y, Takasu Y, et al. GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis. Cell Struct Funct. 2011;36:223-35 pubmed
	Kudelko M, Brault J, Kwok K, Li M, Pardigon N, Peiris J, et al. Class II ADP-ribosylation factors are required for efficient secretion of dengue viruses. J Biol Chem. 2012;287:767-77 pubmed publisher
	Anthonio E, Brees C, Baumgart Vogt E, Hongu T, Huybrechts S, Van Dijck P, et al. Small G proteins in peroxisome biogenesis: the potential involvement of ADP-ribosylation factor 6. BMC Cell Biol. 2009;10:58 pubmed publisher
	Puxeddu E, Uhart M, Li C, Ahmad F, Pacheco Rodriguez G, Manganiello V, et al. Interaction of phosphodiesterase 3A with brefeldin A-inhibited guanine nucleotide-exchange proteins BIG1 and BIG2 and effect on ARF1 activity. Proc Natl Acad Sci U S A. 2009;106:6158-63 pubmed publisher
	Klein S, Partisani M, Franco M, Luton F. EFA6 facilitates the assembly of the tight junction by coordinating an Arf6-dependent and -independent pathway. J Biol Chem. 2008;283:30129-38 pubmed publisher
	Islam A, Shen X, Hiroi T, Moss J, Vaughan M, Levine S. The brefeldin A-inhibited guanine nucleotide-exchange protein, BIG2, regulates the constitutive release of TNFR1 exosome-like vesicles. J Biol Chem. 2007;282:9591-9 pubmed

product information

catalog id :

H00000381-M01

product name :

ARF5 monoclonal antibody (M01), clone 1B4

product description :

Mouse monoclonal antibody raised against a partial recombinant ARF5.

clone name :

1B4

isotype :

IgG1 Kappa

gene name :

ARF5

gene alias :

gene description :

ADP-ribosylation factor 5

genbank accession :

BC003043

immunogen :

ARF5 (AAH03043, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

immunogen sequence protein sequence :

YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDA
VLLVFANKQDMPNAMPVSELTDKLGLQHLRSRTWYVQAT
CATQGTGLYDGLDWLSHELSKR

protein accession :

AAH03043

storage buffer :

In 1x PBS, pH 7.4

storage instruction :

Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing

quality control testing :

Antibody Reactive Against Recombinant Protein

type clonality :

Antibody

raised in host species :

Mouse

antigen species target species :

Human

species reactivity cross reactivity :

Human,Mouse,Rat

application key :

WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr

size :

100 ug

autodate :

2006-10-10

updatetime :

2013-11-15 18:29:55

more info or order :

Abnova product webpage