This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FAS monoclonal antibody (M11), clone 1B6
catalog :
H00000355-M11
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1B6
reactivity :
human
application :
western blot, ELISA, immunoprecipitation
product information
catalog id :
H00000355-M11
product name :
FAS monoclonal antibody (M11), clone 1B6
product description :
Mouse monoclonal antibody raised against a full-length recombinant FAS.
clone name :
1B6
isotype :
IgG2a Kappa
gene name :
FAS
gene alias :
ALPS1A APO-1 APT1 CD95 FAS1 FASTM TNFRSF6
gene description :
Fas (TNF receptor superfamily, member 6)
genbank accession :
BC012479
immunogen :
FAS (AAH12479, 1 a.a. ~ 335 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRK
TVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGD
EPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEI
NCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKE
CTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEV
QKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYIT
TIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQ
KVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQT
IILKDITSDSENSNFRNEIQSLV
TVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGD
EPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEI
NCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKE
CTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEV
QKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYIT
TIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQ
KVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQT
IILKDITSDSENSNFRNEIQSLV
protein accession :
AAH12479
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re,WB-Tr,IP
size :
100 ug
autodate :
2008-06-09
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
