This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
FAS monoclonal antibody (M07), clone 7F12
catalog :
H00000355-M07
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
7F12
reactivity :
human
application :
western blot, ELISA
product information
catalog id :
H00000355-M07
product name :
FAS monoclonal antibody (M07), clone 7F12
product description :
Mouse monoclonal antibody raised against a partial recombinant FAS.
clone name :
7F12
isotype :
IgG1 Kappa
gene name :
FAS
gene alias :
ALPS1A APO-1 APT1 CD95 FAS1 FASTM TNFRSF6
gene description :
Fas (TNF receptor superfamily, member 6)
genbank accession :
NM_000043
immunogen :
FAS (NP_000034, 20 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
SKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQF
CHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHF
SSKCRRCRLCDEGHGLEVEINC
protein accession :
NP_000034
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2008-07-24
updatetime :
2013-11-15 18:40:03
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com
877-853-6098