This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
APEX1 MaxPab rabbit polyclonal antibody (D02)
catalog :
H00000328-D02
quantity :
100 uL
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunocytochemistry, immunoprecipitation
product information
catalog id :
H00000328-D02
product name :
APEX1 MaxPab rabbit polyclonal antibody (D02)
product description :
Rabbit polyclonal antibody raised against a full-length human APEX1 protein.
gene name :
APEX1
gene alias :
APE APE-1 APE1 APEN APEX APX HAP1 REF-1 REF1
gene description :
APEX nuclease (multifunctional DNA repair enzyme) 1
genbank accession :
NM_001641.1
immunogen :
APEX1 (NP_001632.1, 1 a.a. ~ 318 a.a) full-length human protein.
immunogen sequence protein sequence :
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAG
EGPALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKK
KGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQ
YWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGR
VIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKF
LKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTP
QERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNA
RSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPI
TLYLAL
EGPALYEDPPDHKTSPSGKPATLKICSWNVDGLRAWIKK
KGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQ
YWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGR
VIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKF
LKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTP
QERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNA
RSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPI
TLYLAL
protein accession :
NP_001632.1
storage buffer :
No additive
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IF,WB-Tr,IP
size :
100 uL
autodate :
2010-08-23
updatetime :
2010-08-23 00:00:00
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
