This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ANXA2 monoclonal antibody (M02), clone 1G7
catalog :
H00000302-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1G7
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
citations: 2
| Reference |
|---|
product information
catalog id :
H00000302-M02
product name :
ANXA2 monoclonal antibody (M02), clone 1G7
product description :
Mouse monoclonal antibody raised against a full length recombinant ANXA2.
clone name :
1G7
isotype :
IgG1 kappa
gene name :
ANXA2
gene alias :
ANX2 ANX2L4 CAL1H LIP2 LPC2 LPC2D P36 PAP-IV
gene description :
annexin A2
genbank accession :
BC066955
immunogen :
ANXA2 (AAH66955, 19 a.a. ~ 357 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDA
LNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRR
TKKELASALKSALSGHLETVILGLLKTPAQYDASELKAS
MKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLE
KDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDA
RDLYDAGVKRKGTDVPKWISVMTERSVPHLQKVFDRYKS
YSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADR
LYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYG
KSLYYYIQQDTKGDYQKALLYLCGGDD
LNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRR
TKKELASALKSALSGHLETVILGLLKTPAQYDASELKAS
MKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLE
KDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDA
RDLYDAGVKRKGTDVPKWISVMTERSVPHLQKVFDRYKS
YSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADR
LYDSMKGKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYG
KSLYYYIQQDTKGDYQKALLYLCGGDD
protein accession :
AAH66955
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr
size :
100 ug
autodate :
2006-10-10
updatetime :
2013-11-15 18:29:55
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
