This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SLC25A5 monoclonal antibody (M01), clone 1D7
catalog :
H00000292-M01
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1D7
reactivity :
human
product information
catalog id :
H00000292-M01
product name :
SLC25A5 monoclonal antibody (M01), clone 1D7
product description :
Mouse monoclonal antibody raised against a full-length recombinant SLC25A5.
clone name :
1D7
isotype :
IgG2a Kappa
gene name :
SLC25A5
gene alias :
2F1 AAC2 ANT2 T2 T3
gene description :
solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 5
genbank accession :
BC056160
immunogen :
SLC25A5 (AAH56160, 1 a.a. ~ 298 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQ
HASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANV
IRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNL
ASGGAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRG
LGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIY
DTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTV
RRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKG
AWSNVLRGMGGAFVLVLYDEIKKYT
HASKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANV
IRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNL
ASGGAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRG
LGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIY
DTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTV
RRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKG
AWSNVLRGMGGAFVLVLYDEIKKYT
protein accession :
AAH56160
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,ELISA
size :
100 ug
autodate :
6/30/08
updatetime :
11/15/13 18:40
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
