This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
ALPPL2 monoclonal antibody (M07), clone 2B3
catalog :
H00000251-M07
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
2B3
reactivity :
human
application :
western blot, ELISA, immunoprecipitation, immunohistochemistry - paraffin section
product information
catalog id :
H00000251-M07
product name :
ALPPL2 monoclonal antibody (M07), clone 2B3
product description :
Mouse monoclonal antibody raised against a partial recombinant ALPPL2.
clone name :
2B3
isotype :
IgG2a Kappa
gene name :
ALPPL2
gene alias :
ALPG ALPPL GCAP
gene description :
alkaline phosphatase, placental-like 2
genbank accession :
NM_031313
immunogen :
ALPPL2 (NP_112603, 365 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
SEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARD
RKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQS
AVPLDGETHAGE
RKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQS
AVPLDGETHAGE
protein accession :
NP_112603
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
S-ELISA,IP,WB-Tr,RNAi-Ab,ELISA,WB-Re,WB-Ce,IHC-P
size :
100 ug
autodate :
10/10/06
updatetime :
11/15/13 18:29
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
