This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
AKT2 monoclonal antibody (M04A), clone 1F8
catalog :
H00000208-M04A
quantity :
200 uL
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1F8
reactivity :
human, mouse, rat
application :
western blot, ELISA
product information
catalog id :
H00000208-M04A
product name :
AKT2 monoclonal antibody (M04A), clone 1F8
product description :
Mouse monoclonal antibody raised against a partial recombinant AKT2.
clone name :
1F8
isotype :
IgG
gene name :
AKT2
gene alias :
PKBB PKBBETA PRKBB RAC-BETA
gene description :
v-akt murine thymoma viral oncogene homolog 2
genbank accession :
M95936
immunogen :
AKT2 (AAA58364, 100 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
MRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEV
AVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRY
YAMKILRKEVII
AVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRY
YAMKILRKEVII
protein accession :
AAA58364
storage buffer :
In ascites fluid
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human,Mouse,Rat
application key :
WB-Ce,ELISA,WB-Re
size :
200 uL
autodate :
2011-05-05
updatetime :
2011-05-05 16:04:07
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
