This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Abnova
product type :
antibody
product name :
SERPINA3 monoclonal antibody (M02), clone 1C10
catalog :
H00000012-M02
quantity :
100 ug
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
1C10
reactivity :
human
application :
immunocytochemistry, immunohistochemistry - paraffin section
citations: 1
product information
catalog id :
H00000012-M02
product name :
SERPINA3 monoclonal antibody (M02), clone 1C10
product description :
Mouse monoclonal antibody raised against a full-length recombinant SERPINA3.
clone name :
1C10
isotype :
IgG2a Kappa
gene name :
SERPINA3
gene alias :
AACT ACT GIG24 GIG25 MGC88254
gene description :
serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3
genbank accession :
BC003559
immunogen :
SERPINA3 (AAH03559, 25 a.a. ~ 423 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
PNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQ
LVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKG
LKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAM
FVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEM
PFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEE
LSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLK
RWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEA
FTSKADLSGITGARNLAVSQVVHKAVLDVFEEGTEASAA
TAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFM
SKVTNPKQA
LVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKG
LKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAM
FVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEM
PFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEE
LSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLK
RWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEA
FTSKADLSGITGARNLAVSQVVHKAVLDVFEEGTEASAA
TAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFM
SKVTNPKQA
protein accession :
AAH03559
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,IHC-P,S-ELISA,ELISA
size :
100 ug
autodate :
6/30/08
updatetime :
11/15/13 18:40
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
https://www.abnova.com877-853-6098
questions and comments
