product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
CDP/CUTL1 Antibody (CL5278)
catalog :
NBP2-61409
quantity :
100 ul (also 25 ul)
price :
499 USD
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
CL5278
reactivity :
human
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
image
image 1 :

Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody (CL5278) [NBP2-61409] - Staining of SH-SY5Y cells using the Anti-CUX1 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule and nuclear probes are visualized in red and blue, respectively (where available).
product information
brand :
Novus
master code :
NBP2-61409
SKU :
NBP2-61409
product name :
CDP/CUTL1 Antibody (CL5278)
description :
The CDP/CUTL1 Antibody (CL5278) from Novus is a mouse monoclonal antibody to CDP/CUTL1. This antibody reacts with human. The CDP/CUTL1 Antibody (CL5278) has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
target :
CDP/CUTL1
category :
Primary Antibodies
sizes available :
100 ul (also 25 ul)
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Monoclonal
clone :
CL5278
conjugate :
Unconjugated
host :
Mouse
immunogen :
LDPALKQAPLSQSDITILTPKLLSTSPMPTVSSYPPLAI
SLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAAD
CAQGVLRQVKNEVGRSGAWKDHWWS
This antibody was developed against a recombinant protein corresponding to amino acids:
SLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAAD
CAQGVLRQVKNEVGRSGAWKDHWWS
This antibody was developed against a recombinant protein corresponding to amino acids:
isotype :
IgG1
purity :
Protein A purified
species :
Human
gene symbol :
CUX1
images :
https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunocytochemistry-Immunofluorescence-NBP2-61409-img0002.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunocytochemistry-Immunofluorescence-NBP2-61409-img0002.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunohistochemistry-Paraffin-NBP2-61409-img0006.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunohistochemistry-Paraffin-NBP2-61409-img0006.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunocytochemistry-Immunofluorescence-NBP2-61409-img0001.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunocytochemistry-Immunofluorescence-NBP2-61409-img0001.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunohistochemistry-Paraffin-NBP2-61409-img0003.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunohistochemistry-Paraffin-NBP2-61409-img0003.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunohistochemistry-Paraffin-NBP2-61409-img0004.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunohistochemistry-Paraffin-NBP2-61409-img0004.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunohistochemistry-Paraffin-NBP2-61409-img0005.jpg, https://aeroglobalimagesprod.blob.core.windows.net/images/datasheets/CDP-CUTL1-Antibody-(CL5278)-Immunohistochemistry-Paraffin-NBP2-61409-img0005.jpg
applications :
Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin
USD :
499 USD
alt names :
CCAAT displacement protein, CDP/Cux, CDPCCAAT displacement protein, COY1, CUT, cut (Drosophila)-like 1 (CCAAT displacement protein), cut-like 1, CCAAT displacement protein (Drosophila), cut-like homeobox 1, FLJ31745, golgi integral membrane protein 6, GOLIM6, homeobox protein cut-like 1, Homeobox protein cux-1, Nbla10317, p100, p110, p200, p75, protein CASP, putative protein product of Nbla10317
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
