Your Filters
product
- domestic rabbit polyclonal (NA)
reactivity: human, mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation
citations: 9

Western blot analysis of KV11.1 (HERG)-expressing HEK-293 cells: - 1. Anti-KCNH2 (HERG) Antibody (#APC-062), (1:400).2. Anti-KCNH2 (HERG) Antibody, preincubated with KCNH2/HERG Blocking Peptide (#BLP-PC062).
GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS corresponding to amino acid residues 1106-1159 of humanKV11.1 (HERG) (AccessionQ12809). Intracellular C-terminus.
Expression of KV11.1 (HERG) in HEK-293 transfectedcells - Immunocytochemical staining of fixed and permeabilized KV11.1 transfectedHEK-293 cells. Cells were stained withAnti-KCNH2 (HERG) Antibody(#APC-062) followed bygoat anti-rabbit-AlexaFluor-555 secondary antibody (Red). Almost all transfected cells are stained positive for the KV11.1. Arrows indicate cells that do not expressthe channel.
quantity:
price:
to the supplier - domestic rabbit polyclonal (NA)
reactivity: human, mouse, rat
application: western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation
citations: 9

Western blot analysis of HEK 293 cell lysate, stably expressing HERG channels: - 1. Anti-KCNH2 (erg1) Antibody (1:200).2. Anti-KCNH2 (erg1) Antibody, preincubated with KCNH2/erg1 Blocking Peptide (#BLP-PC016).
Peptide (CY)EEL PAGAP ELPQD GPT corresponding to residues 1122-1137 of rat KV11.1 (erg1) (AccessionO08962). Intracellular C-terminal part.
Western blot analysisof HEK 293 cell lysate stably expressing HERG channels: - 1.Anti-KCNH2(erg1) Antibody(1:200).2. Anti-KCNH2(erg1) Antibody preincubated with the negative control antigen.
quantity:
price:
to the supplier - domestic rabbit polyclonal
reactivity: human, mouse, rat
application: western blot, immunohistochemistry, immunohistochemistry - paraffin section
citations: 1 - domestic rabbit polyclonal
reactivity: human, mouse, rat
application: western blot - domestic rabbit polyclonal (polyclonal)
reactivity: rat
application: western blot, immunoprecipitation
gene information - rat Kcnh2
- synonym:ERG1
- description:potassium voltage-gated channel subfamily H member 2
do you know?
- we limit the listing of re-branded antibodies to provide our visitors with accurate information and the best experience
- we manually curate antibody information from the literature to obtain a comprehensive set of well-validated antibodies.
- we limit citation information for polyclonal antibodies to articles published within the last 5 years because the supply of a particular polyclonal antibody preparation is limited.
product type
- Kcnh2 antibody
- Kcnh2 protein
questions and comments

