product information |
| CatalogCode: | | H00003077-D01P |
| Product Name: | | HFE Antibody |
| Product Type: | | Primary Antibodies |
| List Price: | | 335 |
| Clonality: | | Polyclonal |
| Gene ID: | | 3077 |
| Host Name: | | Rabbit |
| CrossReactivity: | | Human |
| Background: | | The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. [provided by RefSeq] |
| ALTnames: | | anti-dJ221C16.10.1 antibody, anti-HFE1 antibody, anti-HH antibody, anti-HLA-H antibody, anti-MGC103790 antibody |
| Immunogen: | | HFE (NP_000401.1, 1 a.a. ~ 348 a.a) full-length human protein. |
| Epitope: | | MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEA
LGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMF
TVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLE
FCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLE
LGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQP
MDAKEFEPKD |
| Specificity: | | Reacts with hemochromatosis. |
| Purity: | | protein A purified |
| Buffer: | | 1x PBS, pH 7.2 |
| Preservative: | | No Preservative |
| PackageSize: | | 0.1mg |
| Uses: | | This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA. |
| Application Summary: | | ELISA, Western Blot |
| Storage: | | Store at -20C. Avoid freeze-thaw cycles. |
| more information or order: | | Novus Biologicals product webpage |
