product information |
| CatalogCode: | | H00003077-B01P |
| Product Name: | | HFE Antibody |
| Product Type: | | Primary Antibodies |
| List Price: | | 295 |
| Clonality: | | Polyclonal |
| Gene ID: | | 3077 |
| Host Name: | | Mouse |
| CrossReactivity: | | Human. |
| Background: | | The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. [provided by RefSeq] |
| ALTnames: | | anti-dJ221C16.10.1 antibody, anti-HFE1 antibody, anti-HH antibody, anti-HLA-H antibody, anti-MGC103790 antibody |
| Immunogen: | | HFE (NP_000401.1, 1 a.a. ~ 348 a.a) full-length human protein. |
| Epitope: | | MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEA
LGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMF
TVDFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLE
FCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLE
LGRGVLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQP
MDAKEFEPKD |
| Specificity: | | HFE - hemochromatosis, |
| Purity: | | protein A purified |
| Preservative: | | No Preservative |
| PackageSize: | | 0.05ml |
| Uses: | | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for FACS analysis. |
| Application Summary: | | Western Blot 1:500, ELISA, flow cytometry / FACS analysis |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| more information or order: | | Novus Biologicals product webpage |
