product information |
| CatalogCode: | | H00003077-A01 |
| Product Name: | | HFE Antibody |
| Product Type: | | Primary Antibodies |
| List Price: | | 235 |
| Clonality: | | Polyclonal |
| Gene ID: | | 3077 |
| Host Name: | | Mouse |
| CrossReactivity: | | Human. Other species not tested. |
| Background: | | The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. |
| ALTnames: | | anti-dJ221C16.10.1 antibody, anti-HFE1 antibody, anti-HH antibody, anti-HLA-H antibody, anti-MGC103790 antibody |
| Immunogen: | | HFE (NP_000401, 115 a.a. ~ 206 a.a) partial recombinant protein with GST tag. |
| Epitope: | | SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAW
PTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ* |
| Specificity: | | HFE - hemochromatosis |
| Purity: | | Whole antisera |
| Buffer: | | This antibody is in antisera and the concentration is unavailable. |
| Preservative: | | No Preservative |
| PackageSize: | | 0.05ml |
| Uses: | | This antibody is useful for ELISA. |
| Application Summary: | | ELISA |
| Storage: | | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| more information or order: | | Novus Biologicals product webpage |
