This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
MyBioSource
product type :
protein
product name :
Recombinant human Activator of 90 kDa heat shock protein ATPase homolog 1
catalog :
MBS717061
quantity :
0.05 mg
price :
195 USD
product information
catalog number :
MBS717061
products type :
Recombinant Protein
products full name :
Recombinant human Activator of 90 kDa heat shock protein ATPase homolog 1
products short name :
Activator of 90 kDa heat shock protein ATPase homolog 1
products name syn :
Recombinant human Activator of 90 kDa heat shock protein ATPase homolog 1 protein
other names :
Homo sapiens AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast) (AHSA1), mRNA; Activator of 90 kDa heat shock protein ATPase homolog 1; activator of 90 kDa heat shock protein ATPase homolog 1; AHA1, activator of heat shock 90kDa protein ATPase homolog 1 (yeast); p38
other gene names :
AHSA1; AHSA1; p38; AHA1; C14orf3; C14orf3; AHA1
uniprot entry name :
AHSA1_HUMAN
host :
E Coli
sequence :
MAKWGEGDPRWIVEERADATNVNNWHWTERDASNWSTDK
LKTLFLAVQVQNEEGKCEVTEVSKLDGEASINNRKGKLI
FFYEWSVKLNWTGTSKSGVQYKGHVEIPNLSDENSVDEV
EISVSLAKDEPDTNLVALMKEEGVKLLREAMGIYISTLK
TEFTQGMILPTMNGESVDPVGQPALKTEERKAKPAPSKT
QARPVGVKIPTCKITLKETFLTSPEELYRVFTTQELVQA
FTHAPATLEADRGGKFHMVDGNVSGEFTDLVPEKHIVMK
WRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEE
ERTRQGWQRYYFEGIKQTFGYGARLF
purity :
0.95
storage stability :
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
other info1 :
Tag Information: GST-tagged
other info2 :
Storage Buffer: PBS pH 7.4, 50% glycerol
products description :
Cochaperone that stimulates HSP90 ATPase activity By similarity. May affect a step in the endoplasmic reticulum to Golgi trafficking.
products references :
[1] "Isolation of a novel gene underexpressed in Down syndrome.
ncbi gi num :
224451069
ncbi acc num :
NP_036243.1
ncbi gb acc num :
NM_012111.2
uniprot acc num :
O95433
ncbi mol weight :
63 KD
uniprot summary :
Function: Cochaperone that stimulates HSP90 ATPase activity . By similarity. May affect a step in the endoplasmic reticulum to Golgi trafficking. Subunit structure: Interacts with HSPCA/HSP90 and with the cytoplasmic tail of the vesicular stomatitis virus glycoprotein (VSV G). Interacts with GCH1. Interacts with SRPK1. Ref.8 Ref.9 Ref.10 Ref.11 Ref.12. Subcellular location: Cytoplasm cytosol. Endoplasmic reticulum. Note: May transiently interact with the endoplasmic reticulum. Ref.8. Tissue specificity: Expressed in numerous tissues, including brain, heart, skeletal muscle and kidney and, at lower levels, liver and placenta. Ref.8. Induction: By heat shock and treatment with the HSP90 inhibitor 17-demethoxygeldanamycin (17AAG). Ref.9. Sequence similarities: Belongs to the AHA1 family.
size :
0.05 mg
price :
195 USD
company information
MyBioSource
P.O. Box 153308
San Diego, CA 92195-3308
sales@mybiosource.com
https://www.mybiosource.com
1-888-627-0165
headquarters: USA
MyBioSource, LLC was orginally founded in Vancouver by three enthusiastic scientists who are passionate about providing the world with the best reagents available. Together, they form a company with a big vision known as MyBioSource. MyBioSource is now located in San Diego, California, USA.

"MyBioSource's number 1 vision is to be the world's number 1 quality reagents provider."

Our goal is to provide researchers, scientists and customers alike with a one-stop-shop for all of their reagents needs, whether it is monoclonal antibody, polyclonal antibody, recombinant protein, peptide, etc...

"MyBioSource offers the best products at unbeatable prices."

Please spend a few minutes to browse our online catalogs and see the wide range of products available. We ship our products through our shipping/distribution facility in San Diego, California, USA.

Would you like to receive email and e-newsletter from MyBioSource about new products, special offers and events? Please click here to join our Mailing List!