product summary
request information :
company name :
Abnova
product type :
antibody
product name :
ITGB3 polyclonal antibody (A01)
catalog :
H00003690-A01
quantity :
50 uL
price :
clonality :
polyclonal
host :
mouse
reactivity :
human
application :
western blot, ELISA
more info or order :
product information
catalog id :
H00003690-A01
product name :
ITGB3 polyclonal antibody (A01)
product description :
Mouse polyclonal antibody raised against a partial recombinant ITGB3.
gene name :
ITGB3
gene alias :
CD61 GP3A GPIIIa
gene description :
integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
genbank accession :
NM_000212
immunogen :
ITGB3 (NP_000203, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
immunogen sequence protein sequence :
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCD
LKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSS
QVTQVSPQRIALRLRPDDSKNFSIQVRQVEDY
protein accession :
NP_000203
storage buffer :
50 % glycerol
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
WB-Ce,ELISA,WB-Re
size :
50 uL
autodate :
2006-10-11
updatetime :
2012-02-16 10:09:06
more info or order :
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
www.abnova.com
877-853-6098