product summary
request information :
company name :
Abnova
product type :
antibody
product name :
ESR1 monoclonal antibody (M01), clone 2F8
catalog :
H00002099-M01
quantity :
100 ug
price :
clonality :
monoclonal
host :
mouse
reactivity :
human
application :
western blot, ELISA, immunocytochemistry
more info or order :
product information
catalog id :
H00002099-M01
product name :
ESR1 monoclonal antibody (M01), clone 2F8
product description :
Mouse monoclonal antibody raised against a full-length recombinant ESR1.
clone name :
2F8
isotype :
IgG2a Kappa
gene name :
ESR1
gene alias :
DKFZp686N23123 ER ESR ESRA Era NR3A1
gene description :
estrogen receptor 1
genbank accession :
NM_000125
immunogen :
ESR1 (NP_000116.2, 41 a.a. ~ 140 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
immunogen sequence protein sequence :
EVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLP
YGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLS
PFLQPHGQQVPYYLENEPSGYT
protein accession :
NP_000116.2
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody Reactive Against Recombinant Protein
type clonality :
Antibody
raised in host species :
Mouse
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,S-ELISA,ELISA,WB-Re
size :
100 ug
autodate :
2008-06-23
updatetime :
2013-11-15 18:40:03
more info or order :
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
www.abnova.com
877-853-6098