product summary
request information :
company name :
Abnova
product type :
antibody
product name :
ESR1 purified MaxPab rabbit polyclonal antibody (D01P)
catalog :
H00002099-D01P
quantity :
100 ug
price :
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot, immunocytochemistry
more info or order :
product information
catalog id :
H00002099-D01P
product name :
ESR1 purified MaxPab rabbit polyclonal antibody (D01P)
product description :
Rabbit polyclonal antibody raised against a full-length human ESR1 protein.
gene name :
ESR1
gene alias :
DKFZp686N23123 ER ESR ESRA Era NR3A1
gene description :
estrogen receptor 1
genbank accession :
NM_000125.2
immunogen :
ESR1 (AAI28574.1, 1 a.a. ~ 595 a.a) full-length human protein.
immunogen sequence protein sequence :
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPL
GEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGL
PYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQL
SPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDN
RRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGY
HYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRR
KSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDD
GEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTA
DQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLAD
RELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIG
LVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLL
ATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKS
LEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQL
LLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDA
HRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYIT
GEAEGFPATV
protein accession :
AAI28574.1
storage buffer :
In 1x PBS, pH 7.4
storage instruction :
Store at -20 C or lower. Aliquot to avoid repeated freezing and thawing
quality control testing :
Antibody reactive against mammalian transfected lysate.
type clonality :
Antibody
raised in host species :
Rabbit
antigen species target species :
Human
species reactivity cross reactivity :
Human
application key :
IF,WB-Tr,Det Ab
size :
100 ug
autodate :
2009-04-20
updatetime :
2013-11-15 18:43:32
more info or order :
company information
Abnova
9th Fl., No.108, Jhouzih St.
Neihu District. Taipei City
114 Taiwan
sales@abnova.com
www.abnova.com
877-853-6098