| gene information - human ERCC2
product
Email me when new information for the following gene becomes available: ERCC2 webpage novusbio -- XPD Products Novus Biologicals antibody, anti-XPD antibody, COFS2, EM9, MGC102762, MGC126218, MGC126219, TTD, XPD .. Home » XPD Products .. anti-COFS2 antibody, anti-EM9 antibody, anti-MGC102762 antibody, anti-MGC126218 antibody, anti-MGC126219 antibody, anti-TTD antibody, anti-XPD antibody, COFS2, EM9, www.novusbio.com/xpdmore from same supplierusbio -- Cloning, ERCC2, Mouse, Primer Pair You are here: Home Cloning Cloning-Sequencing Primers ERCC2, Mouse, Primer Pair (Excision Repair Cross Complement Group 2, EM9, MAG, XPD, ERCC2) .. Mouse XPD/ERCC2 (xeroderma pigmentosum D/ excision repair cross-complementing 2) specific PCR www.usbio.net/displayPage.php?ProdSku=E3451-51Rmore from same supplierrockland-inc yeast cell lysate (lane 1), Y190 yeast cell lysate + human PNK (Gal DNA BP) (lane 2), EM9 XH Chinese hamster ovary cell lysate (lane 3), EM9 XH Chinese hamster ovary cell lysate www.rockland-inc.com/store/DNA-Damage-and-Repair-Antibodies- ...genecopoeia NNYAADSYYNGDIYPVINNATVNGVISTYYLDDGISTNTNANSLTIKNSTIHGMIYSECM TTD .. Product ID: GC-SF0045 www.genecopoeia.com/product/search/view_pathogen.php?prt=5&c ...bethyl it has been found to be the cuase of Cockayne syndrome, and trichothiodystrophy (TTD). .. ERCC3 Antibody www.bethyl.com/category/ERCC3/Antibody/AAAAAAAABAAGAUTmore from same supplierbdbiosciences BD Transduction LaboratoriesTM Technical Data Sheet Purified Mouse Anti-Mouse XPD Product Information Material Number: 611828 Alternate Name: Xeroderma Pigmentosum group .. Application Notes Application Western blot Routinely Tested Immunofluorescence Tested www.bdbiosciences.com/external_files/pm/doc/tds/tl/live/web_ ...sdix -- ERCC2 antibody :: anti ERCC2 :: SDIX b>ERCC2 antibody SEQer™ Antibodies - Successful results in complex assays .. TFIIH Basal Transcription Factor Complex Helicase Subunit antibody, DNA-repair protein complementing XP-D cells antibody, Xeroderma pigmentosum www.sdix.com/Products/Premade-Antibodies/E/ERCC2-antibody.as ...more from same suppliercaltagmedsystems Mouse anti Human ERCC2 monoclonal antibody (M01) .. Mouse anti Human IFNA2 monoclonal antibody (M77) www.caltagmedsystems.co.uk/pricing_ordering/products_orderin ...more from same supplierantageneinc b>ERCC2 .. XPD, XPDC, CXPD www.antageneinc.com/Polyclonal_antibody_to_human.htmlmore from same supplieraustralbiologicals Anti-Excision Repair Cross Complement (ERCC2). IgG fraction (monoclonal) .. IgG fraction from mouse monoclonal antibody (clone 2A10/E2) obtained by immunization of www.australbiologicals.com/index.php?what=catalog&id=361&pri ...more from same supplieribtsystems Product Specifications Anti-Excision Repair Cross Complement (ERCC2). IgG fraction (monoclonal): .. Description: IgG fraction from mouse monoclonal antibody (clone 2A10/E2) obtained by www.ibtsystems.de/products/polyclonal-and-monoclonal-antibod ...more from same supplierfulengen NNYAADSYYNGDIYPVINNATVNGVISTYYLDDGISTNTNANSLTIKNSTIHGMIYSECM TTD .. Product ID: GC-SF0045 www.fulengen.com/product/search/view_pathogen.php?prt=5&cid= ... | product type
species
questions and comments |
